PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family bHLH
Protein Properties Length: 227aa    MW: 25422.6 Da    PI: 10.9938
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014109genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH38.12.7e-124797454
               HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
        HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
               +h  +E++RR+ri   +++Lr +lP++sk+++ Kl Ka++L ++++ +k+L
  Cla014109 47 KHRLAEQNRRNRISGQYATLRAILPSLSKTDKSKLKKASVLSETIRRVKEL 97
               6999**********************99******************99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.3834397IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.62E-846102No hitNo description
SuperFamilySSF474591.44E-1146110IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.4E-104797IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.108.7E-1147101IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.4E-849103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:3.30.70.2607.5E-4140197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MQSIQSYPTS GTMHQIYPQA QPSMIKHYRC PISSFPRKEP ELHAALKHRL AEQNRRNRIS  60
GQYATLRAIL PSLSKTDKSK LKKASVLSET IRRVKELKKL VSEKRAANPE FRDCGVPSGA  120
DRLSLEQCDG GEGMVKAVMS CEDRQDIMAE LAKALKTVKV KLVRAEMVTV GGRNKLSLWM  180
QGPKEGAGGL KRVLEAVMRR PSWIARKPRN AWNSRAPTAN DFNRVAS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-174LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-174LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440558.11e-145PREDICTED: transcription factor bHLH131-like
TrEMBLA0A0A0KG671e-137A0A0A0KG67_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126113032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38070.17e-19bHLH family protein